Big Endothelin-1 (human)
Big Endothelin-1 (human)
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-836 | 0.5mg | 550.00 | + Add to cart |
|
R-M-836 | 1mg | 930.00 | + Add to cart |
|
|
Product description
Big Endothelin-1 (human) comprises residues 53-90 of the endothelin precursor (preproendothelin). Compared to the mature endothelin-1 (hET-1), the peptide show less vasoconstrictor activity in vitro, but similar pressor effects in vivo.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 120796-97-6 |
Sequence | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS |
Synonyms | Big Endothelin-1 (1-38), human, Big ET-1 (1-38) (human) |
Molecular Formula | C₁₈₉H₂₈₂N₄₈O₅₆S₅ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product